PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10033068m
Common NameCICLE_v10032893mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YB
Protein Properties Length: 130aa    MW: 14248.3 Da    PI: 6.5234
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10033068mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.28.6e-5726118193
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                      vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy++plk+yl++yre+
  Ciclev10033068m  26 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLMRYREV 118
                      69*****************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.8E-5223118IPR009072Histone-fold
SuperFamilySSF471131.46E-3829118IPR009072Histone-fold
PfamPF008088.9E-293296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-206078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-207997No hitNo description
PRINTSPR006151.7E-2098116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MAEAPTSPAG GSHESGGEQS PHAGGVREQD RYLPIANISR IMKKALPANG KIAKDAKDTV  60
QECVSEFISF ITSEASDKCQ KEKRKTINGD DLLWAMATLG FEDYIDPLKA YLMRYREVRF  120
LSLLAPPFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B2e-4727117494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4727117494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436198.13e-93hypothetical protein CICLE_v10032893mg
RefseqXP_006436201.13e-93hypothetical protein CICLE_v10032893mg
SwissprotQ8VYK44e-68NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLV4SNQ43e-93V4SNQ4_9R
STRINGPOPTR_0010s22360.14e-74(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.33e-69nuclear factor Y, subunit B8